OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HYAL1 (NM_007312) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315525
Recombinant protein of human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA339811 Rabbit Polyclonal Anti-HYAL1 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HYAL1 or NM_007312"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215525 representing NM_007312
Red=Cloning site Green=Tags(s)

MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPD
MTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFN
WDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNY
DFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPN
LPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILN
VTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRC
YPGWQAPWCERKSMW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_009296
Locus ID 3373
UniProt ID Q12794
Cytogenetics 3p21.31
RefSeq Size 2518
RefSeq ORF 1305
Synonyms HYAL-1; LUCA1; MGC45987; NAT6
Summary This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Secreted Protein
Protein Pathways Glycosaminoglycan degradation, Lysosome, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HYAL1" proteins (12)
SKU Description Size Price
PH315525 HYAL1 MS Standard C13 and N15-labeled recombinant protein (NP_009296) 10 ug
$3,360.00
PH316129 HYAL1 MS Standard C13 and N15-labeled recombinant protein (NP_149349) 10 ug
$3,360.00
LC402131 Lyophilized HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407102 Lyophilized HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407103 Lyophilized HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409678 Lyophilized HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402131 Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY407102 Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 8 (as WB positive control) 100 ug
$665.00
LY407103 Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY409678 Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 7 (as WB positive control) 100 ug
$665.00
TP316129 Recombinant protein of human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 7, 20 µg 20 ug
$867.00
TP721049 Purified recombinant protein of Human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 5 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products