HYAL1 (NM_007312) Human Recombinant Protein
SKU
TP315525
Recombinant protein of human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC215525 representing NM_007312
Red=Cloning site Green=Tags(s) MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPD MTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFN WDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNY DFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPN LPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILN VTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRC YPGWQAPWCERKSMW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_009296 |
Locus ID | 3373 |
UniProt ID | Q12794 |
Cytogenetics | 3p21.31 |
RefSeq Size | 2518 |
RefSeq ORF | 1305 |
Synonyms | HYAL-1; LUCA1; MGC45987; NAT6 |
Summary | This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH315525 | HYAL1 MS Standard C13 and N15-labeled recombinant protein (NP_009296) | 10 ug |
$3,255.00
|
|
PH316129 | HYAL1 MS Standard C13 and N15-labeled recombinant protein (NP_149349) | 10 ug |
$3,255.00
|
|
LC402131 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC407102 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC407103 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC409678 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY402131 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 1 | 100 ug |
$436.00
|
|
LY407102 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 8 | 100 ug |
$665.00
|
|
LY407103 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 2 | 100 ug |
$436.00
|
|
LY409678 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 7 | 100 ug |
$665.00
|
|
TP316129 | Recombinant protein of human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 7, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP721049 | Purified recombinant protein of Human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 5 | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.