HYAL1 (NM_033159) Human Mass Spec Standard

SKU
PH316129
HYAL1 MS Standard C13 and N15-labeled recombinant protein (NP_149349)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216129]
Predicted MW 48.4 kDa
Protein Sequence
Protein Sequence
>RC216129 protein sequence
Red=Cloning site Green=Tags(s)

MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPD
MTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFN
WDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNY
DFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPN
LPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILN
VTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRC
YPGWQAPWCERKSMW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_149349
RefSeq Size 2103
RefSeq ORF 1305
Synonyms HYAL-1; LUCA1; MPS9; NAT6
Locus ID 3373
UniProt ID Q12794
Cytogenetics 3p21.31
Summary This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Protein Pathways Glycosaminoglycan degradation, Lysosome, Metabolic pathways
Write Your Own Review
You're reviewing:HYAL1 (NM_033159) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH315525 HYAL1 MS Standard C13 and N15-labeled recombinant protein (NP_009296) 10 ug
$3,255.00
LC402131 HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407102 HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407103 HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409678 HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402131 Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 1 100 ug
$436.00
LY407102 Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 8 100 ug
$665.00
LY407103 Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 2 100 ug
$436.00
LY409678 Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 7 100 ug
$665.00
TP315525 Recombinant protein of human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316129 Recombinant protein of human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 7, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721049 Purified recombinant protein of Human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 5 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.