G0 Protein alpha (GNAO1) (NM_138736) Human Recombinant Protein

SKU
TP315437
Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215437 protein sequence
Red=Cloning site Green=Tags(s)

MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK
PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC
FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK
KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIK
KSPLTICFPEYTGPSAFTEAVAYIQAQYESKNKSAHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKNLRG
CGLY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_620073
Locus ID 2775
UniProt ID P09471
Cytogenetics 16q13
RefSeq Size 6061
RefSeq ORF 1062
Synonyms DEE17; EIEE17; G-ALPHA-o; GNAO; HLA-DQB1; NEDIM
Summary The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]
Protein Families Druggable Genome
Protein Pathways Long-term depression, Melanogenesis
Write Your Own Review
You're reviewing:G0 Protein alpha (GNAO1) (NM_138736) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH315437 GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_620073) 10 ug
$3,255.00
PH317958 GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_066268) 10 ug
$3,255.00
LC402819 GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408500 GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402819 Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1 100 ug
$436.00
LY408500 Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2 100 ug
$436.00
TP317958 Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.