G0 Protein alpha (GNAO1) (NM_020988) Human Mass Spec Standard

SKU
PH317958
GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_066268)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217958]
Predicted MW 40.1 kDa
Protein Sequence
Protein Sequence
>RC217958 representing NM_020988
Red=Cloning site Green=Tags(s)

MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK
PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC
FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK
KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIK
KSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRG
CGLY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066268
RefSeq Size 3332
RefSeq ORF 1062
Synonyms DEE17; EIEE17; G-ALPHA-o; GNAO; HLA-DQB1; NEDIM
Locus ID 2775
UniProt ID P09471
Cytogenetics 16q13
Summary The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]
Protein Families Druggable Genome
Protein Pathways Long-term depression, Melanogenesis
Write Your Own Review
You're reviewing:G0 Protein alpha (GNAO1) (NM_020988) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH315437 GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_620073) 10 ug
$3,255.00
LC402819 GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408500 GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402819 Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1 100 ug
$436.00
LY408500 Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2 100 ug
$436.00
TP315437 Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2, 20 µg 20 ug
$737.00
TP317958 Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.