PPP1R11 (NM_021959) Human Recombinant Protein

SKU
TP314995
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 11 (PPP1R11), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214995 representing NM_021959
Red=Cloning site Green=Tags(s)

MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAF
GESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_068778
Locus ID 6992
UniProt ID O60927
Cytogenetics 6p22.1
RefSeq Size 1620
RefSeq ORF 378
Synonyms CFAP255; HCG-V; HCGV; IPP3; TCTE5; TCTEX5
Summary This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1. The gene is located within the major histocompatibility complex class I region on chromosome 6. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PPP1R11 (NM_021959) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314995 PPP1R11 MS Standard C13 and N15-labeled recombinant protein (NP_068778) 10 ug
$3,255.00
LC411854 PPP1R11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411854 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 11 (PPP1R11) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.