PPP1R11 (NM_021959) Human Mass Spec Standard

SKU PH314995

PPP1R11 MS Standard C13 and N15-labeled recombinant protein (NP_068778)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC214995]
• Predicted MW: 13.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC214995 representing NM_021959; Red=Cloning site Green=Tags(s); ; MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAF; GESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_068778
• RefSeq Size: 1620
• RefSeq ORF: 378
• Synonyms: CFAP255; HCG-V; HCGV; IPP3; TCTE5; TCTEX5
• Locus ID: 6992
• UniProt ID: O60927
• Cytogenetics: 6p22.1
• Summary: This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1. The gene is located within the major histocompatibility complex class I region on chromosome 6. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome