DPP8 (NM_130434) Human Recombinant Protein

SKU
TP314685
Recombinant protein of human dipeptidyl-peptidase 8 (DPP8), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214685 representing NM_130434
Red=Cloning site Green=Tags(s)

MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFV
KRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLR
ERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPD
WIAFIHSNDIWISNIVTREERRLTYVHNELANMEEDARSAGVATFVLQEEFDRYSGYWWCPKAETTPSGG
KILRILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKVTFKMSEIMIDAEGRIIDVIDKELIQ
PFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVEDDVMERQRLIESVPDSVTPL
IIYEETTDIWINIHDIFHVFPQSHEEEIEFIFASECKTGFRHLYKITSILKESKYKRSSGGLPAPSDFKC
PIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEHHLYVVSYVNPGEVTRLTDRGYSHSCC
ISQHCDFFISKYSNQKNPHCVSLYKLSSPEDDPTCKTKEFWATILDSAGPLPDYTPPEIFSFESTTGFTL
YGMLYKPHDLQPGKKYPTVLFIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVVVIDNRGSCHRGLKFEG
AFKYKMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLSLMALMQRSDIFRVAIAGAPVTLWIF
YDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAHTSILLSFLVRAGKPYD
LQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKVI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 101.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_569118
Locus ID 54878
UniProt ID Q6V1X1
Cytogenetics 15q22.31
RefSeq Size 3146
RefSeq ORF 2646
Synonyms DP8; DPRP-1; DPRP1; MST097; MSTP097; MSTP135; MSTP141
Summary This gene encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protease, Transmembrane
Write Your Own Review
You're reviewing:DPP8 (NM_130434) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314685 DPP8 MS Standard C13 and N15-labeled recombinant protein (NP_569118) 10 ug
$3,255.00
LC403323 DPP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403668 DPP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405157 DPP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430697 DPP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403323 Transient overexpression lysate of dipeptidyl-peptidase 8 (DPP8), transcript variant 1 100 ug
$436.00
LY403668 Transient overexpression lysate of dipeptidyl-peptidase 8 (DPP8), transcript variant 4 100 ug
$436.00
LY405157 Transient overexpression lysate of dipeptidyl-peptidase 8 (DPP8), transcript variant 3 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.