DPP8 (NM_130434) Human Mass Spec Standard

SKU
PH314685
DPP8 MS Standard C13 and N15-labeled recombinant protein (NP_569118)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214685]
Predicted MW 101.2 kDa
Protein Sequence
Protein Sequence
>RC214685 representing NM_130434
Red=Cloning site Green=Tags(s)

MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFV
KRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLR
ERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPD
WIAFIHSNDIWISNIVTREERRLTYVHNELANMEEDARSAGVATFVLQEEFDRYSGYWWCPKAETTPSGG
KILRILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKVTFKMSEIMIDAEGRIIDVIDKELIQ
PFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVEDDVMERQRLIESVPDSVTPL
IIYEETTDIWINIHDIFHVFPQSHEEEIEFIFASECKTGFRHLYKITSILKESKYKRSSGGLPAPSDFKC
PIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEHHLYVVSYVNPGEVTRLTDRGYSHSCC
ISQHCDFFISKYSNQKNPHCVSLYKLSSPEDDPTCKTKEFWATILDSAGPLPDYTPPEIFSFESTTGFTL
YGMLYKPHDLQPGKKYPTVLFIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVVVIDNRGSCHRGLKFEG
AFKYKMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLSLMALMQRSDIFRVAIAGAPVTLWIF
YDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAHTSILLSFLVRAGKPYD
LQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_569118
RefSeq Size 3146
RefSeq ORF 2646
Synonyms DP8; DPRP-1; DPRP1; MST097; MSTP097; MSTP135; MSTP141
Locus ID 54878
UniProt ID Q6V1X1
Cytogenetics 15q22.31
Summary This gene encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protease, Transmembrane
Write Your Own Review
You're reviewing:DPP8 (NM_130434) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403323 DPP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403668 DPP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405157 DPP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430697 DPP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403323 Transient overexpression lysate of dipeptidyl-peptidase 8 (DPP8), transcript variant 1 100 ug
$436.00
LY403668 Transient overexpression lysate of dipeptidyl-peptidase 8 (DPP8), transcript variant 4 100 ug
$436.00
LY405157 Transient overexpression lysate of dipeptidyl-peptidase 8 (DPP8), transcript variant 3 100 ug
$665.00
TP314685 Recombinant protein of human dipeptidyl-peptidase 8 (DPP8), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.