ASRGL1 (NM_001083926) Human Recombinant Protein
SKU
TP314638
Recombinant protein of human asparaginase like 1 (ASRGL1), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC214638 representing NM_001083926
Red=Cloning site Green=Tags(s) MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLN TNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLV TERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYAD NDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTS TSMPWAAAKDGKLHFGIDPDDTTITDLP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001077395 |
Locus ID | 80150 |
UniProt ID | Q7L266 |
Cytogenetics | 11q12.3 |
RefSeq Size | 2424 |
RefSeq ORF | 924 |
Synonyms | ALP; ALP1; CRASH |
Summary | Has both L-asparaginase and beta-aspartyl peptidase activity. May be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Is highly active with L-Asp beta-methyl ester. Besides, has catalytic activity toward beta-aspartyl dipeptides and their methyl esters, including beta-L-Asp-L-Phe, beta-L-Asp-L-Phe methyl ester (aspartame), beta-L-Asp-L-Ala, beta-L-Asp-L-Leu and beta-L-Asp-L-Lys. Does not have aspartylglucosaminidase activity and is inactive toward GlcNAc-L-Asn. Likewise, has no activity toward glutamine.[UniProtKB/Swiss-Prot Function] |
Protein Families | Protease |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH305645 | ASRGL1 MS Standard C13 and N15-labeled recombinant protein (NP_079356) | 10 ug |
$3,255.00
|
|
PH314638 | ASRGL1 MS Standard C13 and N15-labeled recombinant protein (NP_001077395) | 10 ug |
$3,255.00
|
|
LC410905 | ASRGL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421255 | ASRGL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY410905 | Transient overexpression lysate of asparaginase like 1 (ASRGL1), transcript variant 2 | 100 ug |
$436.00
|
|
LY421255 | Transient overexpression lysate of asparaginase like 1 (ASRGL1), transcript variant 1 | 100 ug |
$436.00
|
|
TP305645 | Recombinant protein of human asparaginase like 1 (ASRGL1), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.