ASRGL1 (NM_025080) Human Mass Spec Standard

SKU
PH305645
ASRGL1 MS Standard C13 and N15-labeled recombinant protein (NP_079356)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205645]
Predicted MW 31.9 kDa
Protein Sequence
Protein Sequence
>RC205645 representing NM_025080
Red=Cloning site Green=Tags(s)

MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLN
TNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLV
TERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYAD
NDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTS
TSMPWAAAKDGKLHFGIDPDDTTITDLP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079356
RefSeq Size 1332
RefSeq ORF 924
Synonyms ALP; ALP1; CRASH
Locus ID 80150
UniProt ID Q7L266
Cytogenetics 11q12.3
Summary Has both L-asparaginase and beta-aspartyl peptidase activity. May be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Is highly active with L-Asp beta-methyl ester. Besides, has catalytic activity toward beta-aspartyl dipeptides and their methyl esters, including beta-L-Asp-L-Phe, beta-L-Asp-L-Phe methyl ester (aspartame), beta-L-Asp-L-Ala, beta-L-Asp-L-Leu and beta-L-Asp-L-Lys. Does not have aspartylglucosaminidase activity and is inactive toward GlcNAc-L-Asn. Likewise, has no activity toward glutamine.[UniProtKB/Swiss-Prot Function]
Protein Families Protease
Write Your Own Review
You're reviewing:ASRGL1 (NM_025080) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH314638 ASRGL1 MS Standard C13 and N15-labeled recombinant protein (NP_001077395) 10 ug
$3,255.00
LC410905 ASRGL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421255 ASRGL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410905 Transient overexpression lysate of asparaginase like 1 (ASRGL1), transcript variant 2 100 ug
$436.00
LY421255 Transient overexpression lysate of asparaginase like 1 (ASRGL1), transcript variant 1 100 ug
$436.00
TP305645 Recombinant protein of human asparaginase like 1 (ASRGL1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314638 Recombinant protein of human asparaginase like 1 (ASRGL1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.