NTH1 (NTHL1) (NM_002528) Human Recombinant Protein
SKU
TP314598
Recombinant protein of human nth endonuclease III-like 1 (E. coli) (NTHL1), 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC214598 representing NM_002528
Red=Cloning site Green=Tags(s) MCSPQESGMTALSARMLTRSRSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEG SDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS QTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAE LVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEING LLVGFGQQTCLPVHPRCHACLNQALCPAAQGL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002519 |
Locus ID | 4913 |
UniProt ID | P78549 |
Cytogenetics | 16p13.3 |
RefSeq Size | 1097 |
RefSeq ORF | 936 |
Synonyms | FAP3; hNTH1; NTH1; OCTS3 |
Summary | The protein encoded by this gene is a DNA N-glycosylase of the endonuclease III family. Like a similar protein in E. coli, the encoded protein has DNA glycosylase activity on DNA substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Base excision repair |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH314598 | NTHL1 MS Standard C13 and N15-labeled recombinant protein (NP_002519) | 10 ug |
$3,255.00
|
|
LC419272 | NTHL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419272 | Transient overexpression lysate of nth endonuclease III-like 1 (E. coli) (NTHL1) | 100 ug |
$436.00
|
|
TP760833 | Purified recombinant protein of Human nth endonuclease III-like 1 (E. coli) (NTHL1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.