NTH1 (NTHL1) (NM_002528) Human Mass Spec Standard

SKU
PH314598
NTHL1 MS Standard C13 and N15-labeled recombinant protein (NP_002519)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214598]
Predicted MW 34.2 kDa
Protein Sequence
Protein Sequence
>RC214598 representing NM_002528
Red=Cloning site Green=Tags(s)

MCSPQESGMTALSARMLTRSRSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEG
SDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS
QTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAE
LVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEING
LLVGFGQQTCLPVHPRCHACLNQALCPAAQGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002519
RefSeq Size 1097
RefSeq ORF 936
Synonyms FAP3; hNTH1; NTH1; OCTS3
Locus ID 4913
UniProt ID P78549
Cytogenetics 16p13.3
Summary The protein encoded by this gene is a DNA N-glycosylase of the endonuclease III family. Like a similar protein in E. coli, the encoded protein has DNA glycosylase activity on DNA substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity. [provided by RefSeq, Oct 2008]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Base excision repair
Write Your Own Review
You're reviewing:NTH1 (NTHL1) (NM_002528) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419272 NTHL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419272 Transient overexpression lysate of nth endonuclease III-like 1 (E. coli) (NTHL1) 100 ug
$436.00
TP314598 Recombinant protein of human nth endonuclease III-like 1 (E. coli) (NTHL1), 20 µg 20 ug
$867.00
TP760833 Purified recombinant protein of Human nth endonuclease III-like 1 (E. coli) (NTHL1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.