RGS11 (NM_003834) Human Recombinant Protein

SKU
TP314542
Recombinant protein of human regulator of G-protein signaling 11 (RGS11), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214542 representing NM_003834
Red=Cloning site Green=Tags(s)

MERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEEEALHLGAVLVQHGYIYPLRDP
RSLMLRPDETPYRFQTPYFWTSTLRPAAELDYAIYLAKKNIRKRGTLVDYEKDCYDRLHKKINHAWDLVL
MQAREQLRAAKQRSKGDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIE
YFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDAYWVMNAPTVAAPTKLRVERWG
FSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTLVDAVYEQFLAPGAAHWVNIDS
RTMEQTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRRVFPFTWRPRHS
SPSPALLPTPVEPTAACGPGGGDGVA

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 50.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003825
Locus ID 8786
UniProt ID O94810
Cytogenetics 16p13.3
RefSeq Size 2384
RefSeq ORF 1338
Synonyms RS11
Summary The protein encoded by this gene belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Alternative splicing occurs at this locus and four transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Nov 2013]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RGS11 (NM_003834) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314542 RGS11 MS Standard C13 and N15-labeled recombinant protein (NP_003825) 10 ug
$3,255.00
PH315185 RGS11 MS Standard C13 and N15-labeled recombinant protein (NP_899180) 10 ug
$3,255.00
LC405244 RGS11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418405 RGS11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405244 Transient overexpression lysate of regulator of G-protein signaling 11 (RGS11), transcript variant 1 100 ug
$665.00
LY418405 Transient overexpression lysate of regulator of G-protein signaling 11 (RGS11), transcript variant 2 100 ug
$665.00
TP315185 Recombinant protein of human regulator of G-protein signaling 11 (RGS11), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.