RGS11 (NM_183337) Human Mass Spec Standard

SKU
PH315185
RGS11 MS Standard C13 and N15-labeled recombinant protein (NP_899180)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215185]
Predicted MW 52.8 kDa
Protein Sequence
Protein Sequence
>RC215185 representing NM_183337
Red=Cloning site Green=Tags(s)

MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEE
EALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRFQTPYFWTSTLRPAAELDYAIYLAKKNIRKRGTLVD
YEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRSKGDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRG
SCAASRVLMTKSADFHKREIEYFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDA
YWVMNAPTVAAPTKLRVERWGFSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTL
VDAVYEQFLAPGAAHWVNIDSRTMEQTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAE
AGIPLEMKRRVFPFTWRPRHSSPSPALLPTPVEPTAACGPGGGDGVA

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_899180
RefSeq Size 2373
RefSeq ORF 1401
Synonyms RS11
Locus ID 8786
UniProt ID O94810
Cytogenetics 16p13.3
Summary The protein encoded by this gene belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Alternative splicing occurs at this locus and four transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Nov 2013]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RGS11 (NM_183337) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH314542 RGS11 MS Standard C13 and N15-labeled recombinant protein (NP_003825) 10 ug
$3,255.00
LC405244 RGS11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418405 RGS11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405244 Transient overexpression lysate of regulator of G-protein signaling 11 (RGS11), transcript variant 1 100 ug
$665.00
LY418405 Transient overexpression lysate of regulator of G-protein signaling 11 (RGS11), transcript variant 2 100 ug
$665.00
TP314542 Recombinant protein of human regulator of G-protein signaling 11 (RGS11), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315185 Recombinant protein of human regulator of G-protein signaling 11 (RGS11), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.