Aminomethyltransferase (AMT) (NM_000481) Human Recombinant Protein

SKU
TP314343
Recombinant protein of human aminomethyltransferase (AMT), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214343 representing NM_000481
Red=Cloning site Green=Tags(s)

MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHL
HTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHL
YVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVM
EVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEH
TTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSG
CPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 43.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000472
Locus ID 275
UniProt ID P48728
Cytogenetics 3p21.31
RefSeq Size 2117
RefSeq ORF 1209
Synonyms GCE; GCST; GCVT; NKH
Summary This gene encodes one of four critical components of the glycine cleavage system. Mutations in this gene have been associated with glycine encephalopathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Protein Pathways Glycine, Metabolic pathways, Nitrogen metabolism, One carbon pool by folate, serine and threonine metabolism
Write Your Own Review
You're reviewing:Aminomethyltransferase (AMT) (NM_000481) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314343 AMT MS Standard C13 and N15-labeled recombinant protein (NP_000472) 10 ug
$3,255.00
LC424691 AMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431304 AMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431317 AMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431336 AMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424691 Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
LY431304 Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3 100 ug
$436.00
LY431317 Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
LY431336 Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.