Aminomethyltransferase (AMT) (NM_000481) Human Mass Spec Standard

SKU
PH314343
AMT MS Standard C13 and N15-labeled recombinant protein (NP_000472)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214343]
Predicted MW 43.8 kDa
Protein Sequence
Protein Sequence
>RC214343 representing NM_000481
Red=Cloning site Green=Tags(s)

MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHL
HTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHL
YVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVM
EVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEH
TTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSG
CPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000472
RefSeq Size 2117
RefSeq ORF 1209
Synonyms GCE; GCST; GCVT; NKH
Locus ID 275
UniProt ID P48728
Cytogenetics 3p21.31
Summary This gene encodes one of four critical components of the glycine cleavage system. Mutations in this gene have been associated with glycine encephalopathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Protein Pathways Glycine, Metabolic pathways, Nitrogen metabolism, One carbon pool by folate, serine and threonine metabolism
Write Your Own Review
You're reviewing:Aminomethyltransferase (AMT) (NM_000481) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424691 AMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431304 AMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431317 AMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431336 AMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424691 Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
LY431304 Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3 100 ug
$436.00
LY431317 Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
LY431336 Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4 100 ug
$436.00
TP314343 Recombinant protein of human aminomethyltransferase (AMT), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.