NCALD (NM_001040626) Human Recombinant Protein

SKU
TP314160
Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214160 protein sequence
Red=Cloning site Green=Tags(s)

MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFR
TFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPE
DESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001035716
Locus ID 83988
UniProt ID P61601
Cytogenetics 8q22.3
RefSeq Size 3673
RefSeq ORF 579
Summary This gene encodes a member of the neuronal calcium sensor (NCS) family of calcium-binding proteins. The protein contains an N-terminal myristoylation signal and four EF-hand calcium binding loops. The protein is cytosolic at resting calcium levels; however, elevated intracellular calcium levels induce a conformational change that exposes the myristoyl group, resulting in protein association with membranes and partial co-localization with the perinuclear trans-golgi network. The protein is thought to be a regulator of G protein-coupled receptor signal transduction. Several alternatively spliced variants of this gene have been determined, all of which encode the same protein; additional variants may exist but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NCALD (NM_001040626) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306321 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035720) 10 ug
$3,255.00
PH312908 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035718) 10 ug
$3,255.00
PH313925 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035715) 10 ug
$3,255.00
PH314160 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035716) 10 ug
$3,255.00
PH314659 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_114430) 10 ug
$3,255.00
PH318434 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035719) 10 ug
$3,255.00
PH320693 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035717) 10 ug
$3,255.00
PH321428 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035714) 10 ug
$3,255.00
LC410350 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421783 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421784 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421785 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421786 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421787 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421788 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421789 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410350 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 8 100 ug
$436.00
LY421783 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 1 100 ug
$436.00
LY421784 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 2 100 ug
$436.00
LY421785 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 3 100 ug
$436.00
LY421786 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 4 100 ug
$436.00
LY421787 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 5 100 ug
$436.00
LY421788 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 6 100 ug
$436.00
LY421789 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 7 100 ug
$436.00
TP306321 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 7, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312908 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP313925 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314659 Recombinant protein of human neurocalcin delta (NCALD), transcript variant 8, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318434 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 6, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320693 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321428 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720212 Recombinant protein of human neurocalcin delta (NCALD), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.