NCALD (NM_001040630) Human Mass Spec Standard

SKU
PH306321
NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035720)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206321]
Predicted MW 22.3 kDa
Protein Sequence
Protein Sequence
>RC206321 protein sequence
Red=Cloning site Green=Tags(s)

MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFR
TFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPE
DESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035720
RefSeq Size 3826
RefSeq ORF 579
Locus ID 83988
UniProt ID P61601
Cytogenetics 8q22.3
Summary This gene encodes a member of the neuronal calcium sensor (NCS) family of calcium-binding proteins. The protein contains an N-terminal myristoylation signal and four EF-hand calcium binding loops. The protein is cytosolic at resting calcium levels; however, elevated intracellular calcium levels induce a conformational change that exposes the myristoyl group, resulting in protein association with membranes and partial co-localization with the perinuclear trans-golgi network. The protein is thought to be a regulator of G protein-coupled receptor signal transduction. Several alternatively spliced variants of this gene have been determined, all of which encode the same protein; additional variants may exist but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NCALD (NM_001040630) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312908 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035718) 10 ug
$3,255.00
PH313925 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035715) 10 ug
$3,255.00
PH314160 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035716) 10 ug
$3,255.00
PH314659 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_114430) 10 ug
$3,255.00
PH318434 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035719) 10 ug
$3,255.00
PH320693 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035717) 10 ug
$3,255.00
PH321428 NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035714) 10 ug
$3,255.00
LC410350 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421783 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421784 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421785 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421786 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421787 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421788 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421789 NCALD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410350 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 8 100 ug
$436.00
LY421783 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 1 100 ug
$436.00
LY421784 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 2 100 ug
$436.00
LY421785 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 3 100 ug
$436.00
LY421786 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 4 100 ug
$436.00
LY421787 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 5 100 ug
$436.00
LY421788 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 6 100 ug
$436.00
LY421789 Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 7 100 ug
$436.00
TP306321 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 7, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312908 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP313925 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314160 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314659 Recombinant protein of human neurocalcin delta (NCALD), transcript variant 8, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318434 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 6, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320693 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321428 Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720212 Recombinant protein of human neurocalcin delta (NCALD), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.