Epsin 2 (EPN2) (NM_014964) Human Recombinant Protein

SKU
TP313652
Recombinant protein of human epsin 2 (EPN2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213652 representing NM_014964
Red=Cloning site Green=Tags(s)

MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKN
WRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERL
KAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSPEASLCPQHRT
GAPLGQSEELQPLSQRHPFLPHLGLASRPNGDWSQPCLTCDRAARATSPRVSSELEQARPQTSGEEELQL
QLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQK
AEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATAQSVPKNSDPWAASQQPASS
AGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPF
ESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFLAPGAPATSAPVNPFQVNQPQ
PLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSAAPQPALGATGSSLTPLGPAMMNMVGSVGIPPSAA
QATGTTNPFLL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 68.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055779
Locus ID 22905
UniProt ID O95208
Cytogenetics 17p11.2
RefSeq Size 4814
RefSeq ORF 1923
Synonyms EHB21
Summary This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:Epsin 2 (EPN2) (NM_014964) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310899 EPN2 MS Standard C13 and N15-labeled recombinant protein (NP_683723) 10 ug
$3,255.00
PH313652 EPN2 MS Standard C13 and N15-labeled recombinant protein (NP_055779) 10 ug
$3,255.00
LC407732 EPN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420185 EPN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407732 Transient overexpression lysate of epsin 2 (EPN2), transcript variant 1 100 ug
$436.00
LY420185 Transient overexpression lysate of epsin 2 (EPN2), transcript variant 3 100 ug
$436.00
TP310899 Recombinant protein of human epsin 2 (EPN2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.