Epsin 2 (EPN2) (NM_014964) Human Mass Spec Standard

SKU
PH313652
EPN2 MS Standard C13 and N15-labeled recombinant protein (NP_055779)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213652]
Predicted MW 68.3 kDa
Protein Sequence
Protein Sequence
>RC213652 representing NM_014964
Red=Cloning site Green=Tags(s)

MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKN
WRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERL
KAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSPEASLCPQHRT
GAPLGQSEELQPLSQRHPFLPHLGLASRPNGDWSQPCLTCDRAARATSPRVSSELEQARPQTSGEEELQL
QLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQK
AEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATAQSVPKNSDPWAASQQPASS
AGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPF
ESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFLAPGAPATSAPVNPFQVNQPQ
PLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSAAPQPALGATGSSLTPLGPAMMNMVGSVGIPPSAA
QATGTTNPFLL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055779
RefSeq Size 4814
RefSeq ORF 1923
Synonyms EHB21
Locus ID 22905
UniProt ID O95208
Cytogenetics 17p11.2
Summary This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:Epsin 2 (EPN2) (NM_014964) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310899 EPN2 MS Standard C13 and N15-labeled recombinant protein (NP_683723) 10 ug
$3,255.00
LC407732 EPN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420185 EPN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407732 Transient overexpression lysate of epsin 2 (EPN2), transcript variant 1 100 ug
$436.00
LY420185 Transient overexpression lysate of epsin 2 (EPN2), transcript variant 3 100 ug
$436.00
TP310899 Recombinant protein of human epsin 2 (EPN2), transcript variant 1, 20 µg 20 ug
$737.00
TP313652 Recombinant protein of human epsin 2 (EPN2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.