APE1 (APEX1) (NM_080649) Human Recombinant Protein

  • Product Brand Image
SKU
TP313298
Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 3, 20 µg
  $867.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213298 protein sequence
Red=Cloning site Green=Tags(s)

MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVD
GLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPL
KVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGD
LNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGW
RLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_542380
Locus ID 328
UniProt ID P27695
Cytogenetics 14q11.2
RefSeq Size 1507
RefSeq ORF 954
Synonyms APE; APE1; APEN; APEX; APX; HAP1; REF1
Summary The APEX gene encodes the major AP endonuclease in human cells. It encodes the APEX endonuclease, a DNA repair enzyme with apurinic/apyrimidinic (AP) activity. Such AP activity sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. The AP sites are the most frequent pre-mutagenic lesions that can prevent normal DNA replication. Splice variants have been found for this gene; all encode the same protein. Disruptions in the biological functions related to APEX are associated with many various malignancies and neurodegenerative diseases.provided by RefSeq, Dec 2019
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Base excision repair
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "APE1" proteins (13)
SKU Description Size Price
PH301208 APEX1 MS Standard C13 and N15-labeled recombinant protein (NP_542379) 10 ug
$3,360.00
PH313298 APEX1 MS Standard C13 and N15-labeled recombinant protein (NP_542380) 10 ug
$3,360.00
LC400618 APEX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409118 APEX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409119 APEX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429949 APEX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400618 Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 1 100 ug
$436.00
LY409118 Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2 100 ug
$436.00
LY409119 Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 3 100 ug
$436.00
LY429949 Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 3 100 ug
$436.00
TP301208 Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2, 20 µg 20 ug
$867.00
TP720082 Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 1 10 ug
$275.00
TP760021 Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.