OriGene Logo

HHIPL1 (NM_032425) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313058
Recombinant protein of human HHIP-like 1 (HHIPL1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
In Control Promo
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA342757 Rabbit Polyclonal Anti-HHIPL1 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HHIPL1 or NM_032425"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213058 representing NM_032425
Red=Cloning site Green=Tags(s)

MARARAGALLALWVLGAAAHPQCLDFRPPFRPTQPLRLCAQYSDFGCCDEGRDAELTRRFWALASRVDAA
EWAACAGYARDLLCQECSPYAAHLYDAEDPFTPLRTVPGLCQDYCLDMWHKCRGLFRHLSTDQELWALEG
NLARFCRYLSLDDTDYCFPYLLVNKNLNSNLGHVVADAKGCLQLCLEEVANGLRNPVAMVHARDGTHRFF
VAEQVGLVWAYLPDRSRLGKPFLNISRVVLTSPWEGDERGFLGIAFHPSFQHNRRLYVYYSVGIRSSEWI
RISEFRVSEDDENAVDHSSERIILEVKEPASNHNGGQLLFGDDGYLYIFTGDGGMAGDPFGTFGNAQNKS
ALLGKVLRIDVDRKERGLPYGIPPDNPFVGDPAAQPEVYALGVRNMWRCSFDRGDPSSGTGRGRLFCGDV
GQNKFEEVDVVERGGNYGWRAREGFECYDRSLCANTSLNDLLPIFAYPHTVGKSVTGGYVYRGCEYPNLN
GLYIFGDFMSGRLMSLQENPGTGQWQYSEICMGHGQTCEFPGLINNYYPYIISFGEDEAGELYFMSTGEP
SATAPRGVVYKIIDASSCKARSAMPGYVPAPSVCSSLTSQPFILQWWK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 67.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115801
Locus ID 84439
UniProt ID Q96JK4
Cytogenetics 14q32.2
RefSeq Size 2253
RefSeq ORF 1824
Synonyms KIAA1822; UNQ9245
Summary This gene encodes a protein that belongs to the glucose/sorbosone dehydrogenase family. The encoded protein also contains a domain that binds folate and reduced folic acid derivatives. provided by RefSeq, Jul 2016
Protein Categories Secreated Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "HHIPL1" proteins (5)
SKU Description Size Price
PH313058 HHIPL1 MS Standard C13 and N15-labeled recombinant protein (NP_115801) 10 ug
$3,360.00
LC410121 HHIPL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426741 HHIPL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410121 Transient overexpression lysate of HHIP-like 1 (HHIPL1), transcript variant 2 100 ug
$665.00
LY426741 Transient overexpression lysate of HHIP-like 1 (HHIPL1), transcript variant 1 100 ug
$665.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.