HHIPL1 (NM_032425) Human Mass Spec Standard

SKU
PH313058
HHIPL1 MS Standard C13 and N15-labeled recombinant protein (NP_115801)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213058]
Predicted MW 67.7 kDa
Protein Sequence
Protein Sequence
>RC213058 representing NM_032425
Red=Cloning site Green=Tags(s)

MARARAGALLALWVLGAAAHPQCLDFRPPFRPTQPLRLCAQYSDFGCCDEGRDAELTRRFWALASRVDAA
EWAACAGYARDLLCQECSPYAAHLYDAEDPFTPLRTVPGLCQDYCLDMWHKCRGLFRHLSTDQELWALEG
NLARFCRYLSLDDTDYCFPYLLVNKNLNSNLGHVVADAKGCLQLCLEEVANGLRNPVAMVHARDGTHRFF
VAEQVGLVWAYLPDRSRLGKPFLNISRVVLTSPWEGDERGFLGIAFHPSFQHNRRLYVYYSVGIRSSEWI
RISEFRVSEDDENAVDHSSERIILEVKEPASNHNGGQLLFGDDGYLYIFTGDGGMAGDPFGTFGNAQNKS
ALLGKVLRIDVDRKERGLPYGIPPDNPFVGDPAAQPEVYALGVRNMWRCSFDRGDPSSGTGRGRLFCGDV
GQNKFEEVDVVERGGNYGWRAREGFECYDRSLCANTSLNDLLPIFAYPHTVGKSVTGGYVYRGCEYPNLN
GLYIFGDFMSGRLMSLQENPGTGQWQYSEICMGHGQTCEFPGLINNYYPYIISFGEDEAGELYFMSTGEP
SATAPRGVVYKIIDASSCKARSAMPGYVPAPSVCSSLTSQPFILQWWK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115801
RefSeq Size 2253
RefSeq ORF 1824
Synonyms KIAA1822; UNQ9245
Locus ID 84439
UniProt ID Q96JK4
Cytogenetics 14q32.2
Summary This gene encodes a protein that belongs to the glucose/sorbosone dehydrogenase family. The encoded protein also contains a domain that binds folate and reduced folic acid derivatives. [provided by RefSeq, Jul 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:HHIPL1 (NM_032425) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410121 HHIPL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426741 HHIPL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410121 Transient overexpression lysate of HHIP-like 1 (HHIPL1), transcript variant 2 100 ug
$665.00
LY426741 Transient overexpression lysate of HHIP-like 1 (HHIPL1), transcript variant 1 100 ug
$665.00
TP313058 Recombinant protein of human HHIP-like 1 (HHIPL1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.