PTPN20B (PTPN20) (NM_001042363) Human Recombinant Protein

SKU
TP312878
Purified recombinant protein of Homo sapiens protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212878 representing NM_001042363
Red=Cloning site Green=Tags(s)

MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILE
EKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGE
EYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQI
LQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTG
VFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 39 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001035822
Locus ID 26095
UniProt ID Q4JDL3
Cytogenetics 10q11.22
RefSeq Size 2872
RefSeq ORF 1017
Synonyms bA42B19.1; bA142I17.1; CT126; PTPN20A; PTPN20B
Summary The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites of actin polymerization. A pseudogene of this gene has been defined on chromosome 10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Protein Families Druggable Genome, Phosphatase
Write Your Own Review
You're reviewing:PTPN20B (PTPN20) (NM_001042363) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312878 PTPN20B MS Standard C13 and N15-labeled recombinant protein (NP_001035822) 10 ug
$3,255.00
LC414452 PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420847 PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420852 PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414452 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 2 100 ug
$436.00
LY420847 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 3 100 ug
$436.00
LY420852 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.