PTPN20B (PTPN20) (NM_001042363) Human Mass Spec Standard

SKU
PH312878
PTPN20B MS Standard C13 and N15-labeled recombinant protein (NP_001035822)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212878]
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>RC212878 representing NM_001042363
Red=Cloning site Green=Tags(s)

MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILE
EKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGE
EYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQI
LQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTG
VFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035822
RefSeq Size 2872
RefSeq ORF 1017
Synonyms bA42B19.1; bA142I17.1; CT126; PTPN20A; PTPN20B
Locus ID 26095
UniProt ID Q4JDL3
Cytogenetics 10q11.22
Summary The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites of actin polymerization. A pseudogene of this gene has been defined on chromosome 10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Protein Families Druggable Genome, Phosphatase
Write Your Own Review
You're reviewing:PTPN20B (PTPN20) (NM_001042363) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414452 PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420847 PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420852 PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414452 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 2 100 ug
$436.00
LY420847 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 3 100 ug
$436.00
LY420852 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8 100 ug
$436.00
TP312878 Purified recombinant protein of Homo sapiens protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.