RAP1GDS1 (NM_001100427) Human Recombinant Protein

SKU
TP312781
Recombinant protein of human RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212781 protein sequence
Red=Cloning site Green=Tags(s)

MADNLSDTLKKLKITAVDKTEDSLEGCLDCLLQALAQNNTETSEKIQASGILQLFATLLTPQSSCKAKVA
NIIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDH
LRSLCSITDPANEKLLTVFCGMLMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNL
AELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVD
SDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDAN
CIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEMPPVQ
FKLLGTLRMLIDAQEAAEQLGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSG
GIKHLVTMATSEHVIMQNEALVALALIAALELGTAEKDLESAKLVQILHRLLADERSAPEIKYNSMVLIC
ALMGSECLHKEVQDLAFLDVVSKLRSHENKSVAQQASLTEQRLTVES

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 66.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001093897
Locus ID 5910
UniProt ID P52306
Cytogenetics 4q23
RefSeq Size 3767
RefSeq ORF 1821
Synonyms GDS1; SmgGDS
Summary The smg GDP dissociation stimulator (smgGDS) protein is a stimulatory GDP/GTP exchange protein with GTPase activity (Riess et al., 1993 [PubMed 8262526]).[supplied by OMIM, Feb 2010]
Write Your Own Review
You're reviewing:RAP1GDS1 (NM_001100427) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300924 RAP1GDS1 MS Standard C13 and N15-labeled recombinant protein (NP_066982) 10 ug
$3,255.00
PH312781 RAP1GDS1 MS Standard C13 and N15-labeled recombinant protein (NP_001093897) 10 ug
$3,255.00
LC412050 RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420266 RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420268 RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412050 Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 2 100 ug
$436.00
LY420266 Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 3 100 ug
$665.00
LY420268 Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 5 100 ug
$665.00
TP300924 Recombinant protein of human RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.