OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAP1GDS1 (NM_021159) Human Mass Spec Standard

Be the first to review this product
SKU
PH300924
RAP1GDS1 MS Standard C13 and N15-labeled recombinant protein (NP_066982)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342683 Rabbit Polyclonal Anti-RAP1GDS1 Antibody
100 ul
$585.00
LY420268 Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 5 (as WB positive control) 100 ug
$665.00

Other products for "RAP1GDS1 or NM_021159"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200924
Predicted MW 66.3 kDa
Protein Sequence
Protein Sequence
>RC200924 protein sequence
Red=Cloning site Green=Tags(s)

MADNLSDTLKKLKITAVDKTEDSLEGCLDCLLQALAQNNTETSEKIQASGILQLFATLLTPQSSCKAKVA
NIIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDH
LRSLCSITDPANEKLLTVFCGMLMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNL
AELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVD
SDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDAN
CIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEMPPVQ
FKLLGTLRMLIDAQEAAEQLGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSG
GIKHLVTMATSEHVIMQNEALVALALIAALELGTAEKDLESAKLVQILHRLLADERSAPEIKYNSMVLIC
ALMGSECLHKEVQDLAFLDVVSKLRSHENKSVAQQASLTEQRLTVES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066982
RefSeq Size 3767
RefSeq ORF 1821
Synonyms GDS1; SmgGDS
Locus ID 5910
UniProt ID P52306
Cytogenetics 4q23
Summary The smg GDP dissociation stimulator (smgGDS) protein is a stimulatory GDP/GTP exchange protein with GTPase activity (Riess et al., 1993 PubMed 8262526).supplied by OMIM, Feb 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAP1GDS1" proteins (9)
SKU Description Size Price
PH312781 RAP1GDS1 MS Standard C13 and N15-labeled recombinant protein (NP_001093897) 10 ug
$3,360.00
LC412050 Lyophilized RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420266 Lyophilized RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420268 Lyophilized RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412050 Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420266 Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY420268 Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 5 (as WB positive control) 100 ug
$665.00
TP300924 Recombinant protein of human RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 2, 20 µg 20 ug
$867.00
TP312781 Recombinant protein of human RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products