RAP1GDS1 (NM_021159) Human Mass Spec Standard

SKU
PH300924
RAP1GDS1 MS Standard C13 and N15-labeled recombinant protein (NP_066982)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200924]
Predicted MW 66.3 kDa
Protein Sequence
Protein Sequence
>RC200924 protein sequence
Red=Cloning site Green=Tags(s)

MADNLSDTLKKLKITAVDKTEDSLEGCLDCLLQALAQNNTETSEKIQASGILQLFATLLTPQSSCKAKVA
NIIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDH
LRSLCSITDPANEKLLTVFCGMLMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNL
AELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVD
SDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDAN
CIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEMPPVQ
FKLLGTLRMLIDAQEAAEQLGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSG
GIKHLVTMATSEHVIMQNEALVALALIAALELGTAEKDLESAKLVQILHRLLADERSAPEIKYNSMVLIC
ALMGSECLHKEVQDLAFLDVVSKLRSHENKSVAQQASLTEQRLTVES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066982
RefSeq Size 3767
RefSeq ORF 1821
Synonyms GDS1; SmgGDS
Locus ID 5910
UniProt ID P52306
Cytogenetics 4q23
Summary The smg GDP dissociation stimulator (smgGDS) protein is a stimulatory GDP/GTP exchange protein with GTPase activity (Riess et al., 1993 [PubMed 8262526]).[supplied by OMIM, Feb 2010]
Write Your Own Review
You're reviewing:RAP1GDS1 (NM_021159) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312781 RAP1GDS1 MS Standard C13 and N15-labeled recombinant protein (NP_001093897) 10 ug
$3,255.00
LC412050 RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420266 RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420268 RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412050 Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 2 100 ug
$436.00
LY420266 Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 3 100 ug
$665.00
LY420268 Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 5 100 ug
$665.00
TP300924 Recombinant protein of human RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312781 Recombinant protein of human RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.