FIGLA (NM_001004311) Human Recombinant Protein

SKU
TP312562
Recombinant protein of human folliculogenesis specific basic helix-loop-helix (FIGLA), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212562 representing NM_001004311
Red=Cloning site Green=Tags(s)

MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENLQLVLERRRVA
NAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDLLEGAKDSKKQDPDEQSYSNN
SSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSGEPAHACRHSVMSTTEIISPTRSLDRFPEVE
LLSHRLPQV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001004311
Locus ID 344018
UniProt ID Q6QHK4
Cytogenetics 2p13.3
RefSeq Size 724
RefSeq ORF 657
Synonyms BHLHC8; FIGALPHA; POF6
Summary This gene encodes a protein that functions in postnatal oocyte-specific gene expression. The protein is a basic helix-loop-helix transcription factor that regulates multiple oocyte-specific genes, including genes involved in folliculogenesis and those that encode the zona pellucida. Mutations in this gene cause premature ovarian failure type 6. [provided by RefSeq, Sep 2009]
Write Your Own Review
You're reviewing:FIGLA (NM_001004311) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312562 FIGLA MS Standard C13 and N15-labeled recombinant protein (NP_001004311) 10 ug
$3,255.00
LC424087 FIGLA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424087 Transient overexpression lysate of folliculogenesis specific basic helix-loop-helix (FIGLA) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.