FIGLA (NM_001004311) Human Mass Spec Standard

SKU
PH312562
FIGLA MS Standard C13 and N15-labeled recombinant protein (NP_001004311)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212562]
Predicted MW 23.9 kDa
Protein Sequence
Protein Sequence
>RC212562 representing NM_001004311
Red=Cloning site Green=Tags(s)

MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENLQLVLERRRVA
NAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDLLEGAKDSKKQDPDEQSYSNN
SSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSGEPAHACRHSVMSTTEIISPTRSLDRFPEVE
LLSHRLPQV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001004311
RefSeq Size 724
RefSeq ORF 657
Synonyms BHLHC8; FIGALPHA; POF6
Locus ID 344018
UniProt ID Q6QHK4
Cytogenetics 2p13.3
Summary This gene encodes a protein that functions in postnatal oocyte-specific gene expression. The protein is a basic helix-loop-helix transcription factor that regulates multiple oocyte-specific genes, including genes involved in folliculogenesis and those that encode the zona pellucida. Mutations in this gene cause premature ovarian failure type 6. [provided by RefSeq, Sep 2009]
Write Your Own Review
You're reviewing:FIGLA (NM_001004311) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424087 FIGLA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424087 Transient overexpression lysate of folliculogenesis specific basic helix-loop-helix (FIGLA) 100 ug
$436.00
TP312562 Recombinant protein of human folliculogenesis specific basic helix-loop-helix (FIGLA), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.