Kallikrein 11 (KLK11) (NM_144947) Human Recombinant Protein

SKU
TP312547
Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212547 representing NM_144947
Red=Cloning site Green=Tags(s)

MQRLRWLRDWKSSGRGLTAAKEPGARSSPLQAMRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAA
LFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHR
NDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAY
PGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMK
NN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_659196
Locus ID 11012
UniProt ID Q9UBX7
Cytogenetics 19q13.41
RefSeq Size 1289
RefSeq ORF 846
Synonyms PRSS20; TLSP
Summary Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing and the use of alternate promoters results in multiple transcript variants encoding distinct isoforms which are differentially expressed. [provided by RefSeq, Dec 2016]
Protein Families Druggable Genome, Protease, Secreted Protein
Write Your Own Review
You're reviewing:Kallikrein 11 (KLK11) (NM_144947) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306022 KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_006844) 10 ug
$3,255.00
PH312547 KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_659196) 10 ug
$3,255.00
PH327537 KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_001129504) 10 ug
$3,255.00
LC408096 KLK11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416376 KLK11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427779 KLK11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430122 KLK11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432810 KLK11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408096 Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 100 ug
$436.00
LY416376 Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 1 100 ug
$436.00
LY427779 Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 4 100 ug
$436.00
LY430122 Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 100 ug
$436.00
LY432810 Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 3 100 ug
$436.00
TP306022 Purified recombinant protein of Homo sapiens kallikrein-related peptidase 11 (KLK11), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327537 Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720310 Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.