Kallikrein 11 (KLK11) (NM_144947) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC212547] |
Predicted MW | 30.9 kDa |
Protein Sequence |
Protein Sequence
>RC212547 representing NM_144947
Red=Cloning site Green=Tags(s) MQRLRWLRDWKSSGRGLTAAKEPGARSSPLQAMRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAA LFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHR NDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAY PGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMK NN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_659196 |
RefSeq Size | 1289 |
RefSeq ORF | 846 |
Synonyms | PRSS20; TLSP |
Locus ID | 11012 |
UniProt ID | Q9UBX7 |
Cytogenetics | 19q13.41 |
Summary | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing and the use of alternate promoters results in multiple transcript variants encoding distinct isoforms which are differentially expressed. [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH306022 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_006844) | 10 ug |
$3,255.00
|
|
PH327537 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_001129504) | 10 ug |
$3,255.00
|
|
LC408096 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416376 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427779 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC430122 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432810 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY408096 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 | 100 ug |
$436.00
|
|
LY416376 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 1 | 100 ug |
$436.00
|
|
LY427779 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 4 | 100 ug |
$436.00
|
|
LY430122 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 | 100 ug |
$436.00
|
|
LY432810 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 3 | 100 ug |
$436.00
|
|
TP306022 | Purified recombinant protein of Homo sapiens kallikrein-related peptidase 11 (KLK11), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP312547 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP327537 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720310 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.