HYKK (NM_001013619) Human Recombinant Protein

SKU
TP312299
Recombinant protein of human similar to RIKEN cDNA C630028N24 gene (LOC123688), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212299 representing NM_001013619
Red=Cloning site Green=Tags(s)

MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTK
ASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVS
PQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKNVPLLEKYLYALGQNRNREIVEHVIHLFKEE
VMTKLSHFRECINHGDLNDHNILIESSKSASGNAEYQVSGILDFGDMSYGYYVFEVAITIMYMMIESKSP
IQVGGHVLAGFESITPLTAVEKGALFLLVCSRFCQSLVMAAYSCQLYPENKDYLMVTAKTGWKHLQQMFD
MGQKAVEEIWFETAKSYESGISM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001013641
Locus ID 123688
UniProt ID A2RU49
Cytogenetics 15q25.1
RefSeq Size 1235
RefSeq ORF 1119
Synonyms AGPHD1
Summary Catalyzes the GTP-dependent phosphorylation of 5-hydroxy-L-lysine.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:HYKK (NM_001013619) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312299 AGPHD1 MS Standard C13 and N15-labeled recombinant protein (NP_001013641) 10 ug
$3,255.00
LC421235 HYKK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422983 HYKK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421235 Transient overexpression lysate of aminoglycoside phosphotransferase domain containing 1 (AGPHD1), transcript variant 2 100 ug
$436.00
LY422983 Transient overexpression lysate of aminoglycoside phosphotransferase domain containing 1 (AGPHD1), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.