HYKK (NM_001013619) Human Mass Spec Standard

SKU
PH312299
AGPHD1 MS Standard C13 and N15-labeled recombinant protein (NP_001013641)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212299]
Predicted MW 41.8 kDa
Protein Sequence
Protein Sequence
>RC212299 representing NM_001013619
Red=Cloning site Green=Tags(s)

MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTK
ASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVS
PQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKNVPLLEKYLYALGQNRNREIVEHVIHLFKEE
VMTKLSHFRECINHGDLNDHNILIESSKSASGNAEYQVSGILDFGDMSYGYYVFEVAITIMYMMIESKSP
IQVGGHVLAGFESITPLTAVEKGALFLLVCSRFCQSLVMAAYSCQLYPENKDYLMVTAKTGWKHLQQMFD
MGQKAVEEIWFETAKSYESGISM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001013641
RefSeq Size 1235
RefSeq ORF 1119
Synonyms AGPHD1
Locus ID 123688
UniProt ID A2RU49
Cytogenetics 15q25.1
Summary Catalyzes the GTP-dependent phosphorylation of 5-hydroxy-L-lysine.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:HYKK (NM_001013619) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421235 HYKK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422983 HYKK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421235 Transient overexpression lysate of aminoglycoside phosphotransferase domain containing 1 (AGPHD1), transcript variant 2 100 ug
$436.00
LY422983 Transient overexpression lysate of aminoglycoside phosphotransferase domain containing 1 (AGPHD1), transcript variant 1 100 ug
$436.00
TP312299 Recombinant protein of human similar to RIKEN cDNA C630028N24 gene (LOC123688), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.