RNF22 (TRIM3) (NM_006458) Human Recombinant Protein

SKU
TP311739
Recombinant protein of human tripartite motif-containing 3 (TRIM3), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211739 representing NM_006458
Red=Cloning site Green=Tags(s)

MAKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCPVCRQTSILPE
QGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSVVAGRPLSCPNHEGKTMEFYCEACETAMCGECRA
GEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQ
ALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAA
LAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDK
DGRLVRTGSAELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRALR
PGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQ
GVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIF
SPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAV
NNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSG
SFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNHCFKAYRYLQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 80.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006449
Locus ID 10612
UniProt ID O75382
Cytogenetics 11p15.4
RefSeq Size 3059
RefSeq ORF 2232
Synonyms BERP; HAC1; RNF22; RNF97
Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic filaments. It is similar to a rat protein which is a specific partner for the tail domain of myosin V, a class of myosins which are involved in the targeted transport of organelles. The rat protein can also interact with alpha-actinin-4. Thus it is suggested that this human protein may play a role in myosin V-mediated cargo transport. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RNF22 (TRIM3) (NM_006458) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH311739 TRIM3 MS Standard C13 and N15-labeled recombinant protein (NP_006449) 10 ug
$3,255.00
PH311928 TRIM3 MS Standard C13 and N15-labeled recombinant protein (NP_150594) 10 ug
$3,255.00
LC409625 TRIM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416642 TRIM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409625 Transient overexpression lysate of tripartite motif-containing 3 (TRIM3), transcript variant 2 100 ug
$436.00
LY416642 Transient overexpression lysate of tripartite motif-containing 3 (TRIM3), transcript variant 1 100 ug
$665.00
TP311928 Recombinant protein of human tripartite motif-containing 3 (TRIM3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.