RNF22 (TRIM3) (NM_033278) Human Mass Spec Standard

SKU
PH311928
TRIM3 MS Standard C13 and N15-labeled recombinant protein (NP_150594)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211928]
Predicted MW 80.6 kDa
Protein Sequence
Protein Sequence
>RC211928 representing NM_033278
Red=Cloning site Green=Tags(s)

MAKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCPVCRQTSILPE
QGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSVVAGRPLSCPNHEGKTMEFYCEACETAMCGECRA
GEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQ
ALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAA
LAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDK
DGRLVRTGSAELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRALR
PGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQ
GVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIF
SPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAV
NNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSG
SFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNHCFKAYRYLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_150594
RefSeq Size 2894
RefSeq ORF 2232
Synonyms BERP; HAC1; RNF22; RNF97
Locus ID 10612
UniProt ID O75382
Cytogenetics 11p15.4
Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic filaments. It is similar to a rat protein which is a specific partner for the tail domain of myosin V, a class of myosins which are involved in the targeted transport of organelles. The rat protein can also interact with alpha-actinin-4. Thus it is suggested that this human protein may play a role in myosin V-mediated cargo transport. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RNF22 (TRIM3) (NM_033278) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH311739 TRIM3 MS Standard C13 and N15-labeled recombinant protein (NP_006449) 10 ug
$3,255.00
LC409625 TRIM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416642 TRIM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409625 Transient overexpression lysate of tripartite motif-containing 3 (TRIM3), transcript variant 2 100 ug
$436.00
LY416642 Transient overexpression lysate of tripartite motif-containing 3 (TRIM3), transcript variant 1 100 ug
$665.00
TP311739 Recombinant protein of human tripartite motif-containing 3 (TRIM3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP311928 Recombinant protein of human tripartite motif-containing 3 (TRIM3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.