OTOS (NM_148961) Human Recombinant Protein

SKU TP311259L

Recombinant protein of human otospiralin (OTOS), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211259 protein sequence; Red=Cloning site Green=Tags(s); ; MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTF; FAHFPLGSTLGFHVPYQED; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_683764
• Locus ID: 150677
• UniProt ID: Q8NHW6
• Cytogenetics: 2q37.3
• RefSeq Size: 566
• RefSeq ORF: 267
• Synonyms: OTOSP
• Summary: Otospiralin is synthesized by nonsensory cells (fibrocytes) of the inner ear, and downregulation of otospiralin in guinea pigs leads to deafness (Lavigne-Rebillard et al., 2003 [PubMed 12687421]).[supplied by OMIM, Mar 2008]
• Protein Families: Secreted Protein