COX19 (NM_001031617) Human Recombinant Protein

SKU
TP310770
Recombinant protein of human COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210770 protein sequence
Red=Cloning site Green=Tags(s)

MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ
EPLEKLGFGDLTSGKSEAKK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 10.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001026788
Locus ID 90639
UniProt ID Q49B96
Cytogenetics 7p22.3
RefSeq Size 4896
RefSeq ORF 270
Summary COX19 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox19 protein may play a role in metal transport to the mitochondrial intermembrane space and assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:COX19 (NM_001031617) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310770 COX19 MS Standard C13 and N15-labeled recombinant protein (NP_001026788) 10 ug
$3,255.00
LC422214 COX19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422214 Transient overexpression lysate of COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.