COX19 (NM_001031617) Human Mass Spec Standard

SKU PH310770

COX19 MS Standard C13 and N15-labeled recombinant protein (NP_001026788)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210770]
• Predicted MW: 10.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC210770 protein sequence; Red=Cloning site Green=Tags(s); ; MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ; EPLEKLGFGDLTSGKSEAKK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001026788
• RefSeq Size: 4896
• RefSeq ORF: 270
• Locus ID: 90639
• UniProt ID: Q49B96
• Cytogenetics: 7p22.3
• Summary: COX19 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox19 protein may play a role in metal transport to the mitochondrial intermembrane space and assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]).[supplied by OMIM, Mar 2008]