Tartrate Resistant Acid Phosphatase (ACP5) (NM_001611) Human Recombinant Protein

SKU TP310752

Recombinant protein of human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210752 protein sequence; Red=Cloning site Green=Tags(s); ; MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLG; DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLH; FKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWS; IAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLR; FHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001602
• Locus ID: 54
• UniProt ID: P13686
• Cytogenetics: 19p13.2
• RefSeq Size: 1506
• RefSeq ORF: 975
• Synonyms: HPAP; TRACP5a; TRACP5b; TRAP; TrATPase
• Summary: This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate. [provided by RefSeq, Aug 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Lysosome, Riboflavin metabolism