Tartrate Resistant Acid Phosphatase (ACP5) (NM_001611) Human Mass Spec Standard

SKU
PH310752
ACP5 MS Standard C13 and N15-labeled recombinant protein (NP_001602)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210752]
Predicted MW 36.6 kDa
Protein Sequence
Protein Sequence
>RC210752 protein sequence
Red=Cloning site Green=Tags(s)

MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLG
DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLH
FKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWS
IAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLR
FHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001602
RefSeq Size 1506
RefSeq ORF 975
Synonyms HPAP; TRACP5a; TRACP5b; TRAP; TrATPase
Locus ID 54
UniProt ID P13686
Cytogenetics 19p13.2
Summary This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate. [provided by RefSeq, Aug 2008]
Protein Families Druggable Genome
Protein Pathways Lysosome, Riboflavin metabolism
Write Your Own Review
You're reviewing:Tartrate Resistant Acid Phosphatase (ACP5) (NM_001611) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400607 ACP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426340 ACP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426341 ACP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426342 ACP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400607 Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4 100 ug
$436.00
LY426340 Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2 100 ug
$436.00
LY426341 Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1 100 ug
$436.00
LY426342 Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3 100 ug
$436.00
TP310752 Recombinant protein of human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.