Tartrate Resistant Acid Phosphatase (ACP5) (NM_001611) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC210752] |
Predicted MW | 36.6 kDa |
Protein Sequence |
Protein Sequence
>RC210752 protein sequence
Red=Cloning site Green=Tags(s) MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLG DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLH FKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWS IAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLR FHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001602 |
RefSeq Size | 1506 |
RefSeq ORF | 975 |
Synonyms | HPAP; TRACP5a; TRACP5b; TRAP; TrATPase |
Locus ID | 54 |
UniProt ID | P13686 |
Cytogenetics | 19p13.2 |
Summary | This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate. [provided by RefSeq, Aug 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Lysosome, Riboflavin metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC400607 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426340 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426341 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426342 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400607 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4 | 100 ug |
$436.00
|
|
LY426340 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2 | 100 ug |
$436.00
|
|
LY426341 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1 | 100 ug |
$436.00
|
|
LY426342 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3 | 100 ug |
$436.00
|
|
TP310752 | Recombinant protein of human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.