galectin 9 (LGALS9) (NM_002308) Human Recombinant Protein

SKU
TP310750
Recombinant protein of human lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210750 protein sequence
Red=Cloning site Green=Tags(s)

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGG
YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSV
QLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSIL
LSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILC
EAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002299
Locus ID 3965
UniProt ID O00182
Cytogenetics 17q11.2
RefSeq Size 1739
RefSeq ORF 969
Synonyms HUAT; LGALS9A
Summary The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:galectin 9 (LGALS9) (NM_002308) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310750 LGALS9 MS Standard C13 and N15-labeled recombinant protein (NP_002299) 10 ug
$3,255.00
PH319435 LGALS9 MS Standard C13 and N15-labeled recombinant protein (NP_033665) 10 ug
$3,255.00
LC419406 LGALS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419406 Transient overexpression lysate of lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 2 100 ug
$436.00
TP319435 Purified recombinant protein of Homo sapiens lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.