galectin 9 (LGALS9) (NM_009587) Human Mass Spec Standard

SKU
PH319435
LGALS9 MS Standard C13 and N15-labeled recombinant protein (NP_033665)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219435]
Predicted MW 39.3 kDa
Protein Sequence
Protein Sequence
>RC219435 representing NM_009587
Red=Cloning site Green=Tags(s)

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGG
YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSV
QLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFST
PAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRN
TQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL
THVQT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_033665
RefSeq Size 1696
RefSeq ORF 1065
Synonyms HUAT; LGALS9A
Locus ID 3965
UniProt ID O00182
Cytogenetics 17q11.2
Summary The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:galectin 9 (LGALS9) (NM_009587) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310750 LGALS9 MS Standard C13 and N15-labeled recombinant protein (NP_002299) 10 ug
$3,255.00
LC419406 LGALS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419406 Transient overexpression lysate of lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 2 100 ug
$436.00
TP310750 Recombinant protein of human lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 2, 20 µg 20 ug
$867.00
TP319435 Purified recombinant protein of Homo sapiens lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.