SERP1 (NM_014445) Human Recombinant Protein
SKU
TP310729
Recombinant protein of human stress-associated endoplasmic reticulum protein 1 (SERP1), 20 µg
$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC210729 protein sequence
Red=Cloning site Green=Tags(s) MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_055260 |
Locus ID | 27230 |
UniProt ID | Q9Y6X1 |
Cytogenetics | 3q25.1 |
RefSeq Size | 3181 |
RefSeq ORF | 198 |
Synonyms | RAMP4 |
Summary | Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH310729 | SERP1 MS Standard C13 and N15-labeled recombinant protein (NP_055260) | 10 ug |
$3,255.00
|
|
LC415270 | SERP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY415270 | Transient overexpression lysate of stress-associated endoplasmic reticulum protein 1 (SERP1) | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.