SERP1 (NM_014445) Human Recombinant Protein

SKU
TP310729
Recombinant protein of human stress-associated endoplasmic reticulum protein 1 (SERP1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210729 protein sequence
Red=Cloning site Green=Tags(s)

MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 7.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055260
Locus ID 27230
UniProt ID Q9Y6X1
Cytogenetics 3q25.1
RefSeq Size 3181
RefSeq ORF 198
Synonyms RAMP4
Summary Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SERP1 (NM_014445) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310729 SERP1 MS Standard C13 and N15-labeled recombinant protein (NP_055260) 10 ug
$3,255.00
LC415270 SERP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415270 Transient overexpression lysate of stress-associated endoplasmic reticulum protein 1 (SERP1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.