OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SERP1 (NM_014445) Human Mass Spec Standard

Be the first to review this product
SKU
PH310729
SERP1 MS Standard C13 and N15-labeled recombinant protein (NP_055260)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY415270 Transient overexpression lysate of stress-associated endoplasmic reticulum protein 1 (SERP1) (as WB positive control) 100 ug
$436.00

Other products for "SERP1 or NM_014445"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210729
Predicted MW 7.4 kDa
Protein Sequence
Protein Sequence
>RC210729 protein sequence
Red=Cloning site Green=Tags(s)

MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055260
RefSeq Size 3181
RefSeq ORF 198
Synonyms RAMP4
Locus ID 27230
UniProt ID Q9Y6X1
Cytogenetics 3q25.1
Summary Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SERP1" proteins (3)
SKU Description Size Price
LC415270 Lyophilized SERP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415270 Transient overexpression lysate of stress-associated endoplasmic reticulum protein 1 (SERP1) (as WB positive control) 100 ug
$436.00
TP310729 Recombinant protein of human stress-associated endoplasmic reticulum protein 1 (SERP1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products