SERP1 (NM_014445) Human Mass Spec Standard

SKU PH310729

SERP1 MS Standard C13 and N15-labeled recombinant protein (NP_055260)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210729]
• Predicted MW: 7.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC210729 protein sequence; Red=Cloning site Green=Tags(s); ; MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_055260
• RefSeq Size: 3181
• RefSeq ORF: 198
• Synonyms: RAMP4
• Locus ID: 27230
• UniProt ID: Q9Y6X1
• Cytogenetics: 3q25.1
• Summary: Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane