NOSTRIN (NM_001039724) Human Recombinant Protein

SKU
TP310661
Recombinant protein of human nitric oxide synthase trafficker (NOSTRIN), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210661 protein sequence
Red=Cloning site Green=Tags(s)

MRDPLTDCPYNKVYKNLKEFSQNGENFCKQVTSVLQQRANLEISYAKGLQKLASKLSKALQNTRKSCVSS
AWAWASEGMKSTADLHQKLGKAIELEAIKPTYQVLNVQEKKRKSLDNEVEKTANLVISNWNQQIKAKKKL
MVSTKKHEALFQLVESSKQSMTEKEKRKLLNKLTKSTEKLEKEDENYYQKNMAGYSTRLKWENTLENCYQ
SILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFL
LTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMD
ENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASS
GGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAA
YVEELPSNAGNTATKA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 57.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001034813
Locus ID 115677
UniProt ID Q8IVI9
Cytogenetics 2q24.3
RefSeq Size 1947
RefSeq ORF 1518
Synonyms DaIP2
Summary Nitric oxide (NO) is a potent mediator in biologic processes such as neurotransmission, inflammatory response, and vascular homeostasis. NOSTRIN binds the enzyme responsible for NO production, endothelial NO synthase (ENOS; MIM 163729), and triggers the translocation of ENOS from the plasma membrane to vesicle-like subcellular structures, thereby attenuating ENOS-dependent NO production.[supplied by OMIM, Apr 2004]
Write Your Own Review
You're reviewing:NOSTRIN (NM_001039724) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310661 NOSTRIN MS Standard C13 and N15-labeled recombinant protein (NP_001034813) 10 ug
$3,255.00
LC403273 NOSTRIN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421819 NOSTRIN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403273 Transient overexpression lysate of nitric oxide synthase trafficker (NOSTRIN), transcript variant 1 100 ug
$436.00
LY421819 Transient overexpression lysate of nitric oxide synthase trafficker (NOSTRIN), transcript variant 2 100 ug
$436.00
TP760542 Purified recombinant protein of Human nitric oxide synthase trafficker (NOSTRIN), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.