NOSTRIN (NM_001039724) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC210661] |
Predicted MW | 57.7 kDa |
Protein Sequence |
Protein Sequence
>RC210661 protein sequence
Red=Cloning site Green=Tags(s) MRDPLTDCPYNKVYKNLKEFSQNGENFCKQVTSVLQQRANLEISYAKGLQKLASKLSKALQNTRKSCVSS AWAWASEGMKSTADLHQKLGKAIELEAIKPTYQVLNVQEKKRKSLDNEVEKTANLVISNWNQQIKAKKKL MVSTKKHEALFQLVESSKQSMTEKEKRKLLNKLTKSTEKLEKEDENYYQKNMAGYSTRLKWENTLENCYQ SILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFL LTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMD ENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASS GGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAA YVEELPSNAGNTATKA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001034813 |
RefSeq Size | 1947 |
RefSeq ORF | 1518 |
Synonyms | DaIP2 |
Locus ID | 115677 |
UniProt ID | Q8IVI9 |
Cytogenetics | 2q24.3 |
Summary | Nitric oxide (NO) is a potent mediator in biologic processes such as neurotransmission, inflammatory response, and vascular homeostasis. NOSTRIN binds the enzyme responsible for NO production, endothelial NO synthase (ENOS; MIM 163729), and triggers the translocation of ENOS from the plasma membrane to vesicle-like subcellular structures, thereby attenuating ENOS-dependent NO production.[supplied by OMIM, Apr 2004] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC403273 | NOSTRIN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421819 | NOSTRIN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403273 | Transient overexpression lysate of nitric oxide synthase trafficker (NOSTRIN), transcript variant 1 | 100 ug |
$436.00
|
|
LY421819 | Transient overexpression lysate of nitric oxide synthase trafficker (NOSTRIN), transcript variant 2 | 100 ug |
$436.00
|
|
TP310661 | Recombinant protein of human nitric oxide synthase trafficker (NOSTRIN), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP760542 | Purified recombinant protein of Human nitric oxide synthase trafficker (NOSTRIN), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.