NOSTRIN (NM_001039724) Human Mass Spec Standard

SKU
PH310661
NOSTRIN MS Standard C13 and N15-labeled recombinant protein (NP_001034813)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210661]
Predicted MW 57.7 kDa
Protein Sequence
Protein Sequence
>RC210661 protein sequence
Red=Cloning site Green=Tags(s)

MRDPLTDCPYNKVYKNLKEFSQNGENFCKQVTSVLQQRANLEISYAKGLQKLASKLSKALQNTRKSCVSS
AWAWASEGMKSTADLHQKLGKAIELEAIKPTYQVLNVQEKKRKSLDNEVEKTANLVISNWNQQIKAKKKL
MVSTKKHEALFQLVESSKQSMTEKEKRKLLNKLTKSTEKLEKEDENYYQKNMAGYSTRLKWENTLENCYQ
SILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFL
LTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMD
ENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASS
GGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAA
YVEELPSNAGNTATKA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034813
RefSeq Size 1947
RefSeq ORF 1518
Synonyms DaIP2
Locus ID 115677
UniProt ID Q8IVI9
Cytogenetics 2q24.3
Summary Nitric oxide (NO) is a potent mediator in biologic processes such as neurotransmission, inflammatory response, and vascular homeostasis. NOSTRIN binds the enzyme responsible for NO production, endothelial NO synthase (ENOS; MIM 163729), and triggers the translocation of ENOS from the plasma membrane to vesicle-like subcellular structures, thereby attenuating ENOS-dependent NO production.[supplied by OMIM, Apr 2004]
Write Your Own Review
You're reviewing:NOSTRIN (NM_001039724) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403273 NOSTRIN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421819 NOSTRIN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403273 Transient overexpression lysate of nitric oxide synthase trafficker (NOSTRIN), transcript variant 1 100 ug
$436.00
LY421819 Transient overexpression lysate of nitric oxide synthase trafficker (NOSTRIN), transcript variant 2 100 ug
$436.00
TP310661 Recombinant protein of human nitric oxide synthase trafficker (NOSTRIN), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760542 Purified recombinant protein of Human nitric oxide synthase trafficker (NOSTRIN), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.