ARL13B (NM_144996) Human Recombinant Protein

SKU
TP310490
Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210490 protein sequence
Red=Cloning site Green=Tags(s)

MFSLMASCCGWFKRWREPVRLANKQDKEGALGEADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDK
SIKKGLYWLLHVIARDFDALNERIQKETTEQRALEEQEKQERAERVRKLREERKQNEQEQAELDGTSGLA
ELDPEPTNPFQPIASVIIENEGKLEREKKNQKMEKDSDGCHLKHKMEHEQIETQGQVNHNGQKNNEFGLV
ENYKEALTQQLKNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPK
VTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_659433
Locus ID 200894
UniProt ID Q3SXY8
Cytogenetics 3q11.1-q11.2
RefSeq Size 3670
RefSeq ORF 963
Synonyms ARL2L1; JBTS8
Summary This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Write Your Own Review
You're reviewing:ARL13B (NM_144996) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310490 ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_659433) 10 ug
$3,255.00
PH321949 ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_878899) 10 ug
$3,255.00
LC405389 ARL13B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408134 ARL13B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432892 ARL13B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405389 Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1 100 ug
$665.00
LY408134 Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2 100 ug
$436.00
LY432892 Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 4 100 ug
$436.00
TP321949 Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.