ARL13B (NM_144996) Human Mass Spec Standard

SKU
PH310490
ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_659433)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210490]
Predicted MW 36.8 kDa
Protein Sequence
Protein Sequence
>RC210490 protein sequence
Red=Cloning site Green=Tags(s)

MFSLMASCCGWFKRWREPVRLANKQDKEGALGEADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDK
SIKKGLYWLLHVIARDFDALNERIQKETTEQRALEEQEKQERAERVRKLREERKQNEQEQAELDGTSGLA
ELDPEPTNPFQPIASVIIENEGKLEREKKNQKMEKDSDGCHLKHKMEHEQIETQGQVNHNGQKNNEFGLV
ENYKEALTQQLKNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPK
VTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659433
RefSeq Size 3670
RefSeq ORF 963
Synonyms ARL2L1; JBTS8
Locus ID 200894
UniProt ID Q3SXY8
Cytogenetics 3q11.1-q11.2
Summary This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Write Your Own Review
You're reviewing:ARL13B (NM_144996) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321949 ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_878899) 10 ug
$3,255.00
LC405389 ARL13B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408134 ARL13B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432892 ARL13B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405389 Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1 100 ug
$665.00
LY408134 Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2 100 ug
$436.00
LY432892 Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 4 100 ug
$436.00
TP310490 Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2, 20 µg 20 ug
$867.00
TP321949 Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.