ARL13B (NM_144996) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC210490] |
Predicted MW | 36.8 kDa |
Protein Sequence |
Protein Sequence
>RC210490 protein sequence
Red=Cloning site Green=Tags(s) MFSLMASCCGWFKRWREPVRLANKQDKEGALGEADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDK SIKKGLYWLLHVIARDFDALNERIQKETTEQRALEEQEKQERAERVRKLREERKQNEQEQAELDGTSGLA ELDPEPTNPFQPIASVIIENEGKLEREKKNQKMEKDSDGCHLKHKMEHEQIETQGQVNHNGQKNNEFGLV ENYKEALTQQLKNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPK VTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_659433 |
RefSeq Size | 3670 |
RefSeq ORF | 963 |
Synonyms | ARL2L1; JBTS8 |
Locus ID | 200894 |
UniProt ID | Q3SXY8 |
Cytogenetics | 3q11.1-q11.2 |
Summary | This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH321949 | ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_878899) | 10 ug |
$3,255.00
|
|
LC405389 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC408134 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432892 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405389 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1 | 100 ug |
$665.00
|
|
LY408134 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2 | 100 ug |
$436.00
|
|
LY432892 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 4 | 100 ug |
$436.00
|
|
TP310490 | Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP321949 | Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.