SPTSSB (NM_001040100) Human Recombinant Protein
SKU
TP310453
Recombinant protein of human chromosome 3 open reading frame 57 (C3orf57), 20 µg
$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC210453 protein sequence
Red=Cloning site Green=Tags(s) MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGY HSTISN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001035189 |
Locus ID | 165679 |
UniProt ID | Q8NFR3 |
Cytogenetics | 3q26.1 |
RefSeq Size | 2306 |
RefSeq ORF | 228 |
Synonyms | ADMP; C3orf57; SSSPTB |
Summary | Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH310453 | C3orf57 MS Standard C13 and N15-labeled recombinant protein (NP_001035189) | 10 ug |
$3,255.00
|
|
LC421673 | SPTSSB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY421673 | Transient overexpression lysate of chromosome 3 open reading frame 57 (C3orf57) | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.