SPTSSB (NM_001040100) Human Mass Spec Standard

SKU
PH310453
C3orf57 MS Standard C13 and N15-labeled recombinant protein (NP_001035189)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210453]
Predicted MW 9.2 kDa
Protein Sequence
Protein Sequence
>RC210453 protein sequence
Red=Cloning site Green=Tags(s)

MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGY
HSTISN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035189
RefSeq Size 2306
RefSeq ORF 228
Synonyms ADMP; C3orf57; SSSPTB
Locus ID 165679
UniProt ID Q8NFR3
Cytogenetics 3q26.1
Summary Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SPTSSB (NM_001040100) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421673 SPTSSB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421673 Transient overexpression lysate of chromosome 3 open reading frame 57 (C3orf57) 100 ug
$436.00
TP310453 Recombinant protein of human chromosome 3 open reading frame 57 (C3orf57), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.